G0S2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: G0S2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9970
• Hersteller Artikelnummer: A9970
• Alternativnummer: ABB-A9970-100UL,ABB-A9970-20UL,ABB-A9970-1000UL,ABB-A9970-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: G0S2

Produktbeschreibung

Involved in extrinsic apoptotic signaling pathway and positive regulation of extrinsic apoptotic signaling pathway. Located in mitochondrion.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 11kDa
• NCBI: 50486
• UniProt: P27469
• Reinheit: Affinity purification
• Sequenz: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ
• Target-Kategorie: G0S2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer.

Bilder

Western blot analysis of various lysates using G0S2 Rabbit pAb (A9970) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.