G0S2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: G0S2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9970
• Supplier Catalog Number: A9970
• Alternative Catalog Number: ABB-A9970-100UL,ABB-A9970-20UL,ABB-A9970-1000UL,ABB-A9970-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: G0S2

Product Description

Involved in extrinsic apoptotic signaling pathway and positive regulation of extrinsic apoptotic signaling pathway. Located in mitochondrion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 11kDa
• NCBI: 50486
• UniProt: P27469
• Purity: Affinity purification
• Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ
• Target: G0S2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer.

Images

Western blot analysis of various lysates using G0S2 Rabbit pAb (A9970) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.