MZT2B Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MZT2B Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9984
• Hersteller Artikelnummer: A9984
• Alternativnummer: ABB-A9984-100UL,ABB-A9984-20UL,ABB-A9984-500UL,ABB-A9984-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FAM128B, MOZART2B, MZT2B

Produktbeschreibung

Located in cytosol, microtubule cytoskeleton, and nucleoplasm. Part of gamma-tubulin large complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 16kDa
• NCBI: 80097
• UniProt: Q6NZ67
• Reinheit: Affinity purification
• Sequenz: MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
• Target-Kategorie: MZT2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome.

Bilder

Western blot analysis of various lysates using MZT2B Rabbit pAb (A9984) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.