MZT2B Rabbit pAb, Unconjugated

Product Overview

• Article Name: MZT2B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9984
• Supplier Catalog Number: A9984
• Alternative Catalog Number: ABB-A9984-100UL,ABB-A9984-20UL,ABB-A9984-500UL,ABB-A9984-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FAM128B, MOZART2B, MZT2B

Product Description

Located in cytosol, microtubule cytoskeleton, and nucleoplasm. Part of gamma-tubulin large complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 16kDa
• NCBI: 80097
• UniProt: Q6NZ67
• Purity: Affinity purification
• Sequence: MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
• Target: MZT2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome.

Images

Western blot analysis of various lysates using MZT2B Rabbit pAb (A9984) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.