SLC2A13 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SLC2A13 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9993
• Hersteller Artikelnummer: A9993
• Alternativnummer: ABB-A9993-100UL,ABB-A9993-20UL,ABB-A9993-1000UL,ABB-A9993-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HMIT, SLC2A13

Produktbeschreibung

Enables ATPase binding activity, myo-inositol:proton symporter activity, and protease binding activity. Involved in myo-inositol transport and positive regulation of amyloid-beta formation. Is integral component of plasma membrane. Part of cell body, cell periphery, and cell projection.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 70kDa
• NCBI: 114134
• UniProt: Q96QE2
• Reinheit: Affinity purification
• Sequenz: LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
• Target-Kategorie: SLC2A13
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease.

Bilder

Western blot analysis of various lysates using SLC2A13 Rabbit pAb (A9993) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.