SLC2A13 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SLC2A13 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9993
• Supplier Catalog Number: A9993
• Alternative Catalog Number: ABB-A9993-100UL,ABB-A9993-20UL,ABB-A9993-1000UL,ABB-A9993-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HMIT, SLC2A13

Product Description

Enables ATPase binding activity, myo-inositol:proton symporter activity, and protease binding activity. Involved in myo-inositol transport and positive regulation of amyloid-beta formation. Is integral component of plasma membrane. Part of cell body, cell periphery, and cell projection.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 70kDa
• NCBI: 114134
• UniProt: Q96QE2
• Purity: Affinity purification
• Sequence: LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
• Target: SLC2A13
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease.

Images

Western blot analysis of various lysates using SLC2A13 Rabbit pAb (A9993) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.