Actin (plant specific) Rabbit pAb, IgG1, Unconjugated

Produktübersicht

• Artikelname: Actin (plant specific) Rabbit pAb, IgG1, Unconjugated
• Artikelnummer: ABB-AC053
• Hersteller Artikelnummer: AC053
• Alternativnummer: ABB-AC053-100UL,ABB-AC053-1000UL,ABB-AC053-500UL,ABB-AC053-50UL,ABB-AC053-200UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: A. thaliana
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ACT12, Actin(Plant Specific)

Produktbeschreibung

Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Produkteigenschaften

• Konzentration: WB
• Molekulargewicht: 45kDa
• Isotyp: IgG1
• Reinheit: Affinity purification
• Sequenz: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP
• Target-Kategorie: ACT12

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000
• Anwendungsbeschreibung: Cross-Reactivity: Widely Range,Oryza sativa, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation.

Bilder

Western blot analysis of lysates from Oryza sativa usingplant actin Rabbit pAb (AC053) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:(ECL Basic Kit (RM00020)).
Exposure time: 180s.