Actin (plant specific) Rabbit pAb, IgG1, Unconjugated

Product Overview

• Article Name: Actin (plant specific) Rabbit pAb, IgG1, Unconjugated
• Biozol Catalog Number: ABB-AC053
• Supplier Catalog Number: AC053
• Alternative Catalog Number: ABB-AC053-100UL,ABB-AC053-1000UL,ABB-AC053-500UL,ABB-AC053-50UL,ABB-AC053-200UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: A. thaliana
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ACT12, Actin(Plant Specific)

Product Description

Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Product Properties

• Concentration: WB
• Molecular Weight: 45kDa
• Isotype: IgG1
• Purity: Affinity purification
• Sequence: MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP
• Target: ACT12

Application Notes

• Application Dilute: WB,1:1000 - 1:5000
• Application Notes: Cross-Reactivity: Widely Range,Oryza sativa, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation.

Images

Western blot analysis of lysates from Oryza sativa usingplant actin Rabbit pAb (AC053) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:(ECL Basic Kit (RM00020)).
Exposure time: 180s.