Rabbit anti MBP-Tag pAb, Unconjugated

Produktübersicht

• Artikelname: Rabbit anti MBP-Tag pAb, Unconjugated
• Artikelnummer: ABB-AE137
• Hersteller Artikelnummer: AE137
• Alternativnummer: ABB-AE137-100UL,ABB-AE137-200UL,ABB-AE137-1000UL,ABB-AE137-500UL,ABB-AE137-50UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: E. coli
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ECK4026

Produktbeschreibung

Biofilm microarray result was validated with RT-PCR. [More information is available at EcoGene: EG10554]. In addition to being the periplasmic substrate-binding component of the maltose ABC transporter, MalE with bound substrate is also able to bind to the chemoreceptor Tar to induce chemotaxis toward maltose.

Produkteigenschaften

• Konzentration: WB
• Molekulargewicht: 43kDa
• NCBI: 948538
• UniProt: P0AEX9
• Reinheit: Affinity purification
• Sequenz: KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS
• Target-Kategorie: malE

Anwendungsbeschreibung

• Application Verdünnung: WB,1:10000 - 1:60000
• Anwendungsbeschreibung: Cross-Reactivity: Species independent

Bilder

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with MBP Tag using Rabbit anti MBP Tag pAb (AE137) at 1:10000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.