Rabbit anti MBP-Tag pAb, Unconjugated

Product Overview

• Article Name: Rabbit anti MBP-Tag pAb, Unconjugated
• Biozol Catalog Number: ABB-AE137
• Supplier Catalog Number: AE137
• Alternative Catalog Number: ABB-AE137-100UL,ABB-AE137-200UL,ABB-AE137-1000UL,ABB-AE137-500UL,ABB-AE137-50UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: E. coli
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ECK4026

Product Description

Biofilm microarray result was validated with RT-PCR. [More information is available at EcoGene: EG10554]. In addition to being the periplasmic substrate-binding component of the maltose ABC transporter, MalE with bound substrate is also able to bind to the chemoreceptor Tar to induce chemotaxis toward maltose.

Product Properties

• Concentration: WB
• Molecular Weight: 43kDa
• NCBI: 948538
• UniProt: P0AEX9
• Purity: Affinity purification
• Sequence: KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS
• Target: malE

Application Notes

• Application Dilute: WB,1:10000 - 1:60000
• Application Notes: Cross-Reactivity: Species independent

Images

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with MBP Tag using Rabbit anti MBP Tag pAb (AE137) at 1:10000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.