Phospho-Syk-Y323 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Phospho-Syk-Y323 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-AP0500
• Hersteller Artikelnummer: AP0500
• Alternativnummer: ABB-AP0500-1000UL,ABB-AP0500-500UL,ABB-AP0500-100UL,ABB-AP0500-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IMD82, p72-Syk, Phospho-Syk-Y323

Produktbeschreibung

This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 72kDa
• NCBI: 6850
• UniProt: P43405
• Reinheit: Affinity purification
• Sequenz: NPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRG
• Target-Kategorie: SYK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Protein phosphorylation,Signal Transduction,Kinase,Tyrosine kinases,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood.

Bilder

Western blot analysis of lysates from U-937 cells usingPhospho-Syk-Y323 Rabbit pAb (AP0500) at1:500 dilution. U-937 cells were treated with ATP(5 mM) at 30°C for 1 hour.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.