Phospho-Syk-Y323 Rabbit pAb, Unconjugated

Catalog Number: ABB-AP0500
Article Name: Phospho-Syk-Y323 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-AP0500
Supplier Catalog Number: AP0500
Alternative Catalog Number: ABB-AP0500-1000UL,ABB-AP0500-500UL,ABB-AP0500-100UL,ABB-AP0500-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IMD82, p72-Syk, Phospho-Syk-Y323
This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 6850
UniProt: P43405
Purity: Affinity purification
Sequence: NPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRG
Target: SYK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Protein phosphorylation,Signal Transduction,Kinase,Tyrosine kinases,PI3K-Akt Signaling Pathway,ErbB-HER Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood.
Western blot analysis of lysates from U-937 cells usingPhospho-Syk-Y323 Rabbit pAb (AP0500) at1:500 dilution. U-937 cells were treated with ATP(5 mM) at 30°C for 1 hour.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.