Recombinant Human TIE2/TEK/CD202b Protein

Produktübersicht

• Artikelname: Recombinant Human TIE2/TEK/CD202b Protein
• Artikelnummer: ABB-RP00373
• Hersteller Artikelnummer: RP00373
• Alternativnummer: ABB-RP00373-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Immunogen: Ala23-Leu748
• Alternative Synonym: Tie-2, Angiopoietin-1 receptor, TEK, VMCM, VMCM1, CD202b

Produktbeschreibung

Angiopoietin-1 (Ang-1) is the primary agonist for Tie2 tyrosine kinase receptor (Tie2), and the effect of Ang-1-Tie2 signalling is context-dependent. Deficiency in either Ang-1 or Tie2 protein leads to severe microvascular defects and subsequent embryoni

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method
• Molekulargewicht: 82.09 kDa
• NCBI: 7010
• UniProt: Q02763
• Reinheit: > 95% by SDS-PAGE,> 95% by HPLC
• Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequenz: AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKS
• Target-Kategorie: TIE2

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.