Recombinant Human TIE2/TEK/CD202b Protein

Product Overview

• Article Name: Recombinant Human TIE2/TEK/CD202b Protein
• Biozol Catalog Number: ABB-RP00373
• Supplier Catalog Number: RP00373
• Alternative Catalog Number: ABB-RP00373-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Immunogen: Ala23-Leu748
• Alternative Names: Tie-2, Angiopoietin-1 receptor, TEK, VMCM, VMCM1, CD202b

Product Description

Angiopoietin-1 (Ang-1) is the primary agonist for Tie2 tyrosine kinase receptor (Tie2), and the effect of Ang-1-Tie2 signalling is context-dependent. Deficiency in either Ang-1 or Tie2 protein leads to severe microvascular defects and subsequent embryoni

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method
• Molecular Weight: 82.09 kDa
• NCBI: 7010
• UniProt: Q02763
• Purity: > 95% by SDS-PAGE,> 95% by HPLC
• Form: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequence: AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKS
• Target: TIE2

Application Notes

• Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.