PE-Labeled Recombinant Human HER1/ERBB1/EGFR (25-378) Protein

Produktübersicht

• Artikelname: PE-Labeled Recombinant Human HER1/ERBB1/EGFR (25-378) Protein
• Artikelnummer: ABB-RP00500PLQ
• Hersteller Artikelnummer: RP00500PLQ
• Alternativnummer: ABB-RP00500PLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Leu25-Ser378
• Alternative Synonym: ErbB, EC 2.7.10, EC 2.7.10.1, EGFR, mENA, LEGFR, ERBB, ERBB1, HER1, PIG61, NISBD2

Produktbeschreibung

The epidermal growth factor receptor (EGFR) is overexpressed in a variety of human epithelial tumors, often as a consequence of gene amplification. Tumors with EGFR gene amplification frequently contain EGFR gene rearrangements, with the most common extracellular domain mutation being EGFRvIII. This mutation leads to a deletion of exons 2-7 of the EGFR gene and renders the mutant receptor incapable of binding any known ligand.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method
• Molekulargewicht: 41.6 kDa
• NCBI: 1956
• UniProt: NP_001333870.1
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEP
• Target-Kategorie: EGFRVIII

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets

Bilder

FACS Analysis of Anti-EGFRVIII CAR Expression. 293T cells were transfected with anti-EGFRVIII-scFv and His tag. Cells were incubated with 5 µg/mL PE-Labeled Human EGFRVIII, His Tag and PE-labeled protein control. Non-transfected 293T cells and PE-labeled protein control were used as negative control.