PE-Labeled Recombinant Human HER1/ERBB1/EGFR (25-378) Protein

Product Overview

• Article Name: PE-Labeled Recombinant Human HER1/ERBB1/EGFR (25-378) Protein
• Biozol Catalog Number: ABB-RP00500PLQ
• Supplier Catalog Number: RP00500PLQ
• Alternative Catalog Number: ABB-RP00500PLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Leu25-Ser378
• Alternative Names: ErbB, EC 2.7.10, EC 2.7.10.1, EGFR, mENA, LEGFR, ERBB, ERBB1, HER1, PIG61, NISBD2

Product Description

The epidermal growth factor receptor (EGFR) is overexpressed in a variety of human epithelial tumors, often as a consequence of gene amplification. Tumors with EGFR gene amplification frequently contain EGFR gene rearrangements, with the most common extracellular domain mutation being EGFRvIII. This mutation leads to a deletion of exons 2-7 of the EGFR gene and renders the mutant receptor incapable of binding any known ligand.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method
• Molecular Weight: 41.6 kDa
• NCBI: 1956
• UniProt: NP_001333870.1
• Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequence: LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEP
• Target: EGFRVIII

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets

Images

FACS Analysis of Anti-EGFRVIII CAR Expression. 293T cells were transfected with anti-EGFRVIII-scFv and His tag. Cells were incubated with 5 µg/mL PE-Labeled Human EGFRVIII, His Tag and PE-labeled protein control. Non-transfected 293T cells and PE-labeled protein control were used as negative control.