FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein

Produktübersicht

• Artikelname: FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein
• Artikelnummer: ABB-RP00526FLQ
• Hersteller Artikelnummer: RP00526FLQ
• Alternativnummer: ABB-RP00526FLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Leu50-Pro193
• Alternative Synonym: CD70 molecule, CD70, TNFSF7, CD27 Ligand, CD27-L, CD27LG,?Ki-24 antigen, TNFSF7G

Produktbeschreibung

CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 51.8 kDa
• NCBI: 970
• UniProt: P32970
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
• Target-Kategorie: CD27 Ligand/CD70 Trimer

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Bilder

FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70&,nbsp, Trimer Protein was determined by Tris-Bis PAGE under reducing conditions.