FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein

Catalog Number: ABB-RP00526FLQ
Article Name: FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein
Biozol Catalog Number: ABB-RP00526FLQ
Supplier Catalog Number: RP00526FLQ
Alternative Catalog Number: ABB-RP00526FLQ-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Leu50-Pro193
Alternative Names: CD70 molecule, CD70, TNFSF7, CD27 Ligand, CD27-L, CD27LG,?Ki-24 antigen, TNFSF7G
CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 51.8 kDa
NCBI: 970
UniProt: P32970
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
Sequence: LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Target: CD27 Ligand/CD70 Trimer
Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens
FITC-Labeled Recombinant Human TNFSF7/CD27 Ligand/CD70&,nbsp, Trimer Protein was determined by Tris-Bis PAGE under reducing conditions.