FITC-Labeled Recombinant Human Siglec-3/CD33 Protein

Artikelnummer: ABB-RP00555FLQ
Artikelname: FITC-Labeled Recombinant Human Siglec-3/CD33 Protein
Artikelnummer: ABB-RP00555FLQ
Hersteller Artikelnummer: RP00555FLQ
Alternativnummer: ABB-RP00555FLQ-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Asp18-His259
Alternative Synonym: CD33 molecule, CD33, FLJ00391, gp67, Siglec3, Siglec-3, p67
Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state.They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and Siglecs 5 to 11. To date, no Siglec has been shown to recognized any cell surface ligand other than sialic acids, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 29.6 kDa
NCBI: 945
UniProt: P20138
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as 0.22 µm filtered solution in 10 mM NaH2PO4, 2 mM EDTA, 500 mM NaCl (pH 7.4).
Sequenz: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Target-Kategorie: Siglec-3/CD33
Application Verdünnung: Supplied as 0.22 µm filtered solution in 10 mM NaH2PO4, 2 mM EDTA, 500 mM NaCl (pH 7.4).
Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens
FITC-Labeled Recombinant Human Siglec-3/CD33 Protein was determined by Tris-Bis PAGE under reducing conditions.