FITC-Labeled Recombinant Human Siglec-3/CD33 Protein

Product Overview

• Article Name: FITC-Labeled Recombinant Human Siglec-3/CD33 Protein
• Biozol Catalog Number: ABB-RP00555FLQ
• Supplier Catalog Number: RP00555FLQ
• Alternative Catalog Number: ABB-RP00555FLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Asp18-His259
• Alternative Names: CD33 molecule, CD33, FLJ00391, gp67, Siglec3, Siglec-3, p67

Product Description

Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state.They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and Siglecs 5 to 11. To date, no Siglec has been shown to recognized any cell surface ligand other than sialic acids, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 29.6 kDa
• NCBI: 945
• UniProt: P20138
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as 0.22 µm filtered solution in 10 mM NaH2PO4, 2 mM EDTA, 500 mM NaCl (pH 7.4).
• Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
• Target: Siglec-3/CD33

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in 10 mM NaH2PO4, 2 mM EDTA, 500 mM NaCl (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Images

FITC-Labeled Recombinant Human Siglec-3/CD33 Protein was determined by Tris-Bis PAGE under reducing conditions.