FITC-Labeled Recombinant Human Siglec-2/CD22 Protein

Artikelnummer: ABB-RP00579FLQ
Artikelname: FITC-Labeled Recombinant Human Siglec-2/CD22 Protein
Artikelnummer: ABB-RP00579FLQ
Hersteller Artikelnummer: RP00579FLQ
Alternativnummer: ABB-RP00579FLQ-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Asp20-Arg687
Alternative Synonym: CD22 molecule, CD22, Siglec-2, B-cell receptor CD22, BL-CAM, SIGLEC2, SIGLEC2FLJ22814
CD22, or cluster of differentiation-22, is a molecule belonging to the SIGLEC family of lectins. It is found on the surface of mature B cells and to a lesser extent on some immature B cells. CD22 a member of the immunoglobulin superfamily. CD22 functions as an inhibitory receptor for B cell receptor (BCR) signaling. It is also involved in the B cell trafficking to Peyers patches in mice.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 101.9 kDa
NCBI: 933
UniProt: P20273
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
Sequenz: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEY
Target-Kategorie: Siglec-2/CD22
Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens
FITC-Labeled Recombinant Human Siglec-2/CD22 Protein was determined by Tris-Bis PAGE under reducing conditions.