FITC-Labeled Recombinant Human Siglec-2/CD22 Protein

Product Overview

• Article Name: FITC-Labeled Recombinant Human Siglec-2/CD22 Protein
• Biozol Catalog Number: ABB-RP00579FLQ
• Supplier Catalog Number: RP00579FLQ
• Alternative Catalog Number: ABB-RP00579FLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Asp20-Arg687
• Alternative Names: CD22 molecule, CD22, Siglec-2, B-cell receptor CD22, BL-CAM, SIGLEC2, SIGLEC2FLJ22814

Product Description

CD22, or cluster of differentiation-22, is a molecule belonging to the SIGLEC family of lectins. It is found on the surface of mature B cells and to a lesser extent on some immature B cells. CD22 a member of the immunoglobulin superfamily. CD22 functions as an inhibitory receptor for B cell receptor (BCR) signaling. It is also involved in the B cell trafficking to Peyers patches in mice.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 101.9 kDa
• NCBI: 933
• UniProt: P20273
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequence: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEY
• Target: Siglec-2/CD22

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Images

FITC-Labeled Recombinant Human Siglec-2/CD22 Protein was determined by Tris-Bis PAGE under reducing conditions.