PE-Labeled Recombinant Human CD7 Protein

Produktübersicht

• Artikelname: PE-Labeled Recombinant Human CD7 Protein
• Artikelnummer: ABB-RP00588PLQ
• Hersteller Artikelnummer: RP00588PLQ
• Alternativnummer: ABB-RP00588PLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Ala26-Pro180
• Alternative Synonym: CD7 molecule, CD7, LEU-9, Tp40, TP41, GP40

Produktbeschreibung

CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method
• Molekulargewicht: 19.3 kDa
• NCBI: 924
• UniProt: P09564
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Target-Kategorie: CD7

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Bilder

Immobilized PE-Labeled Human CD7, His Tag at 0.5 µg/mL (100 µL/well) on the plate. Dose response curve for Anti-CD7 Antibody, hFc Tag with the EC<,sub>,50<,/sub>, of 9.2ng/mL determined by ELISA.