PE-Labeled Recombinant Human CD7 Protein

Product Overview

• Article Name: PE-Labeled Recombinant Human CD7 Protein
• Biozol Catalog Number: ABB-RP00588PLQ
• Supplier Catalog Number: RP00588PLQ
• Alternative Catalog Number: ABB-RP00588PLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Ala26-Pro180
• Alternative Names: CD7 molecule, CD7, LEU-9, Tp40, TP41, GP40

Product Description

CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method
• Molecular Weight: 19.3 kDa
• NCBI: 924
• UniProt: P09564
• Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Target: CD7

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Images

Immobilized PE-Labeled Human CD7, His Tag at 0.5 µg/mL (100 µL/well) on the plate. Dose response curve for Anti-CD7 Antibody, hFc Tag with the EC<,sub>,50<,/sub>, of 9.2ng/mL determined by ELISA.