FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein

Produktübersicht

• Artikelname: FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein
• Artikelnummer: ABB-RP00612FLQ
• Hersteller Artikelnummer: RP00612FLQ
• Alternativnummer: ABB-RP00612FLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Ala54
• Alternative Synonym: CD269, TNFRSF17, BCMA, BCM, TNFRSF13A

Produktbeschreibung

B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 8.9 kDa
• NCBI: 608
• UniProt: Q02223
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
• Target-Kategorie: BCMA/TNFRSF17

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Bilder

FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein was determined by Tris-Bis PAGE under reducing conditions.