FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein

Product Overview

• Article Name: FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein
• Biozol Catalog Number: ABB-RP00612FLQ
• Supplier Catalog Number: RP00612FLQ
• Alternative Catalog Number: ABB-RP00612FLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Ala54
• Alternative Names: CD269, TNFRSF17, BCMA, BCM, TNFRSF13A

Product Description

B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 8.9 kDa
• NCBI: 608
• UniProt: Q02223
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
• Target: BCMA/TNFRSF17

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Images

FITC-Labeled Recombinant Human TNFRSF17/BCMA/CD269 Protein was determined by Tris-Bis PAGE under reducing conditions.