FITC-Labeled Recombinant Human B7-H3/CD276 Protein

Produktübersicht

• Artikelname: FITC-Labeled Recombinant Human B7-H3/CD276 Protein
• Artikelnummer: ABB-RP00635FLQ
• Hersteller Artikelnummer: RP00635FLQ
• Alternativnummer: ABB-RP00635FLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Leu29-Pro245
• Alternative Synonym: B7H3, B7-H3, CD276, PSEC0249, UNQ309, PRO352, B7 homolog 3, CD276

Produktbeschreibung

B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 50.1 kDa
• NCBI: 80381
• UniProt: Q5ZPR3
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
• Target-Kategorie: B7-H3/CD276

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Bilder

FITC-Labeled Recombinant Human B7-H3/CD276 Protein was determined by Tris-Bis PAGE under reducing conditions.