FITC-Labeled Recombinant Human B7-H3/CD276 Protein

Product Overview

• Article Name: FITC-Labeled Recombinant Human B7-H3/CD276 Protein
• Biozol Catalog Number: ABB-RP00635FLQ
• Supplier Catalog Number: RP00635FLQ
• Alternative Catalog Number: ABB-RP00635FLQ-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Leu29-Pro245
• Alternative Names: B7H3, B7-H3, CD276, PSEC0249, UNQ309, PRO352, B7 homolog 3, CD276

Product Description

B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 50.1 kDa
• NCBI: 80381
• UniProt: Q5ZPR3
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
• Target: B7-H3/CD276

Application Notes

• Application Dilute: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Application Notes: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Images

FITC-Labeled Recombinant Human B7-H3/CD276 Protein was determined by Tris-Bis PAGE under reducing conditions.