Recombinant Mouse IFN-gamma Protein, Human

Artikelnummer: ABB-RP01070
Artikelname: Recombinant Mouse IFN-gamma Protein, Human
Artikelnummer: ABB-RP01070
Hersteller Artikelnummer: RP01070
Alternativnummer: ABB-RP01070-20UG, ABB-RP01070-100UG, ABB-RP01070-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Met1-Cys155
Alternative Synonym: IFG,IFI,IFN gamma,Interferon Gamma,IFNG
Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 44.70 kDa
NCBI: 15978
UniProt: P01580
Reinheit: 90 % as determined by SDS-PAGE, 90 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Target-Kategorie: IFN-gamma
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors,Cell Culture related