Recombinant Human IGF-I Protein, E. coli

Artikelnummer: ABB-RP01875
Artikelname: Recombinant Human IGF-I Protein, E. coli
Artikelnummer: ABB-RP01875
Hersteller Artikelnummer: RP01875
Alternativnummer: ABB-RP01875-100UG, ABB-RP01875-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Immunogen: Gly49-Ala118
Alternative Synonym: Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C,IGF1, IBP1
IGF I, also known as Mechano Growth Factor, somatomedin-C, IGF-I, and IGF1, is a secreted protein that belongs to the insulin family. The insulin family, comprised of insulin, relaxin, insulin-like growth factors I and II ( IGF-I and IGF-II ), and possib
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 7.59 kDa
NCBI: 3479
UniProt: P05019
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Target-Kategorie: IGF1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.