Recombinant Human IGF-I Protein, E. coli

Catalog Number: ABB-RP01875
Article Name: Recombinant Human IGF-I Protein, E. coli
Biozol Catalog Number: ABB-RP01875
Supplier Catalog Number: RP01875
Alternative Catalog Number: ABB-RP01875-100UG, ABB-RP01875-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Immunogen: Gly49-Ala118
Alternative Names: Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C,IGF1, IBP1
IGF I, also known as Mechano Growth Factor, somatomedin-C, IGF-I, and IGF1, is a secreted protein that belongs to the insulin family. The insulin family, comprised of insulin, relaxin, insulin-like growth factors I and II ( IGF-I and IGF-II ), and possib
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 7.59 kDa
NCBI: 3479
UniProt: P05019
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Target: IGF1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.