Recombinant Human IGF-II Protein

Artikelnummer: ABB-RP01878
Artikelname: Recombinant Human IGF-II Protein
Artikelnummer: ABB-RP01878
Hersteller Artikelnummer: RP01878
Alternativnummer: ABB-RP01878-50UG,ABB-RP01878-500UG,ABB-RP01878-1000UG,ABB-RP01878-10UG,ABB-RP01878-100UG,ABB-RP01878-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: (Ala25-Glu91)
Alternative Synonym: IGF2,C11orf43,GRDF,IGF-II,PP9974
This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 33.44 kDa
NCBI: 3481
UniProt: P01344
Reinheit: 85% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of 50mMTris,100mM Glycine,pH7.5.
Sequenz: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Target-Kategorie: IGF2
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of 50mMTris,100mM Glycine,pH7.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Growth Factor