Recombinant Human IGF-II Protein

Catalog Number: ABB-RP01878
Article Name: Recombinant Human IGF-II Protein
Biozol Catalog Number: ABB-RP01878
Supplier Catalog Number: RP01878
Alternative Catalog Number: ABB-RP01878-50UG,ABB-RP01878-500UG,ABB-RP01878-1000UG,ABB-RP01878-10UG,ABB-RP01878-100UG,ABB-RP01878-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: (Ala25-Glu91)
Alternative Names: IGF2,C11orf43,GRDF,IGF-II,PP9974
This protein belongs a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 33.44 kDa
NCBI: 3481
UniProt: P01344
Purity: 85% as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of 50mMTris,100mM Glycine,pH7.5.
Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Target: IGF2
Application Dilute: Lyophilized from a 0.2 µm filtered solution of 50mMTris,100mM Glycine,pH7.5.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Growth Factor