Recombinant Human NKG-2D/KLRK1/CD314 Protein

Artikelnummer: ABB-RP01879
Artikelname: Recombinant Human NKG-2D/KLRK1/CD314 Protein
Artikelnummer: ABB-RP01879
Hersteller Artikelnummer: RP01879
Alternativnummer: ABB-RP01879-10UG,ABB-RP01879-100UG,ABB-RP01879-1000UG,ABB-RP01879-50UG,ABB-RP01879-500UG,ABB-RP01879-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: ILe73-Val216
Alternative Synonym: KLR,CD314,NKG2D,NKG2-D
NKG2D is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors, also known as KLRK1, CD314, D12S2489E, KLR and killer cell lectin like receptor K1. NKG2D itself forms a homodimer whose ectodomains serve for ligand binding. NKG2D is a major recognition receptor for the detection and elimination of transformed and infected cells as its ligands are induced during cellular stress, either as a result of infection or genomic stress such as in cancer. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity. The function of NKG2D on CD8+ T cells is to send co-stimulatory signals to activate them.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 42.61 kDa
NCBI: 22914
UniProt: P26718
Reinheit: 85% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Target-Kategorie: CD314
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens