Recombinant Human NKG-2D/KLRK1/CD314 Protein

Catalog Number: ABB-RP01879
Article Name: Recombinant Human NKG-2D/KLRK1/CD314 Protein
Biozol Catalog Number: ABB-RP01879
Supplier Catalog Number: RP01879
Alternative Catalog Number: ABB-RP01879-10UG,ABB-RP01879-100UG,ABB-RP01879-1000UG,ABB-RP01879-50UG,ABB-RP01879-500UG,ABB-RP01879-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: ILe73-Val216
Alternative Names: KLR,CD314,NKG2D,NKG2-D
NKG2D is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors, also known as KLRK1, CD314, D12S2489E, KLR and killer cell lectin like receptor K1. NKG2D itself forms a homodimer whose ectodomains serve for ligand binding. NKG2D is a major recognition receptor for the detection and elimination of transformed and infected cells as its ligands are induced during cellular stress, either as a result of infection or genomic stress such as in cancer. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity. The function of NKG2D on CD8+ T cells is to send co-stimulatory signals to activate them.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 42.61 kDa
NCBI: 22914
UniProt: P26718
Purity: 85% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Target: CD314
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens