Recombinant Mouse IGF-I Protein, Human

Produktübersicht

• Artikelname: Recombinant Mouse IGF-I Protein, Human
• Artikelnummer: ABB-RP01887
• Hersteller Artikelnummer: RP01887
• Alternativnummer: ABB-RP01887-10UG,ABB-RP01887-100UG,ABB-RP01887-1000UG,ABB-RP01887-20UG,ABB-RP01887-50UG,ABB-RP01887-500UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Immunogen: Gly49-Ala118
• Alternative Synonym: Igf1, Igf-1,Insulin-like growth factor I, IGF-I, Somatomedin

Produktbeschreibung

Insulin-like growth factor I, also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Mouse IGF-I/IGF-1 is synthesized as two precursor isoforms with alternate N- and C-terminal propeptides . These isoforms are differentially expressed by various tissues. The 7.6 kDa mature IGF-I/IGF-1 is identical between isoforms and is generated by proteolytic removal of the N- and C-terminal regions. Mature mouse IGF-I/IGF-1 shares 94% and 99% aa sequence identity with human and rat IGF-I/IGF-1, respectively, and exhibits cross-species activity. It shares 60% aa sequence identity with mature mouse IGF-II/IGF-2. Circulating IGF-I/IGF-1 is produced by hepatocytes, while local IGF-I is produced by many other tissues in which it has paracrine effects . IGF-I induces the proliferation, migration, and differentiation of a wide variety of cell types during development and postnatally . IGF-I regulates glucose and fatty acid metabolism, steroid hormone activity, and cartilage and bone metabolism . It plays an important role in muscle regeneration and tumor progression. IGF-I binds IGF-I R, IGF-II R, and the insulin receptor, although its effects are mediated primarily by IGF-I R. IGF-I association with IGF binding proteins increases its plasma half-life and modulates its interactions with receptors.

Produkteigenschaften

• Konzentration: < 0.01 EU/µg of the protein by LAL method
• Molekulargewicht: 33.64 kDa
• NCBI: 16000
• UniProt: P05017
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
• Target-Kategorie: Igf1

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Growth factor,Cell Culture related