Recombinant Mouse IGF-I Protein, Human

Catalog Number: ABB-RP01887
Article Name: Recombinant Mouse IGF-I Protein, Human
Biozol Catalog Number: ABB-RP01887
Supplier Catalog Number: RP01887
Alternative Catalog Number: ABB-RP01887-10UG,ABB-RP01887-100UG,ABB-RP01887-1000UG,ABB-RP01887-20UG,ABB-RP01887-50UG,ABB-RP01887-500UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Gly49-Ala118
Alternative Names: Igf1, Igf-1,Insulin-like growth factor I, IGF-I, Somatomedin
Insulin-like growth factor I, also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Mouse IGF-I/IGF-1 is synthesized as two precursor isoforms with alternate N- and C-terminal propeptides . These isoforms are differentially expressed by various tissues. The 7.6 kDa mature IGF-I/IGF-1 is identical between isoforms and is generated by proteolytic removal of the N- and C-terminal regions. Mature mouse IGF-I/IGF-1 shares 94% and 99% aa sequence identity with human and rat IGF-I/IGF-1, respectively, and exhibits cross-species activity. It shares 60% aa sequence identity with mature mouse IGF-II/IGF-2. Circulating IGF-I/IGF-1 is produced by hepatocytes, while local IGF-I is produced by many other tissues in which it has paracrine effects . IGF-I induces the proliferation, migration, and differentiation of a wide variety of cell types during development and postnatally . IGF-I regulates glucose and fatty acid metabolism, steroid hormone activity, and cartilage and bone metabolism . It plays an important role in muscle regeneration and tumor progression. IGF-I binds IGF-I R, IGF-II R, and the insulin receptor, although its effects are mediated primarily by IGF-I R. IGF-I association with IGF binding proteins increases its plasma half-life and modulates its interactions with receptors.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 33.64 kDa
NCBI: 16000
UniProt: P05017
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Target: Igf1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Growth factor,Cell Culture related