Recombinant Rat Follistatin/FST Protein, Human

Artikelnummer: ABB-RP01893
Artikelname: Recombinant Rat Follistatin/FST Protein, Human
Artikelnummer: ABB-RP01893
Hersteller Artikelnummer: RP01893
Alternativnummer: ABB-RP01893-20UG,ABB-RP01893-50UG,ABB-RP01893-500UG,ABB-RP01893-1000UG,ABB-RP01893-10UG,ABB-RP01893-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Immunogen: Met1-Trp344
Alternative Synonym: Fst,Follistatin, FS, Activin-binding protein
Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation, negative regulation of transcription by RNA polymerase II, and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development, keratinocyte proliferation, and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 38.68 kDa
NCBI: 24373
UniProt: P21674
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKK
Target-Kategorie: Fst
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related