Recombinant Rat Follistatin/FST Protein, Human

Catalog Number: ABB-RP01893
Article Name: Recombinant Rat Follistatin/FST Protein, Human
Biozol Catalog Number: ABB-RP01893
Supplier Catalog Number: RP01893
Alternative Catalog Number: ABB-RP01893-20UG,ABB-RP01893-50UG,ABB-RP01893-500UG,ABB-RP01893-1000UG,ABB-RP01893-10UG,ABB-RP01893-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Rat
Immunogen: Met1-Trp344
Alternative Names: Fst,Follistatin, FS, Activin-binding protein
Enables heparan sulfate proteoglycan binding activity. Predicted to be involved in hematopoietic progenitor cell differentiation, negative regulation of transcription by RNA polymerase II, and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including animal organ development, keratinocyte proliferation, and positive regulation of hair follicle development. Predicted to be located in cytoplasm and nucleus. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in polycystic ovary syndrome. Orthologous to human FST (follistatin).
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 38.68 kDa
NCBI: 24373
UniProt: P21674
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKK
Target: Fst
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related