Recombinant Mouse Endoglin/ENG/CD105 Protein, Human

Artikelnummer: ABB-RP01912
Artikelname: Recombinant Mouse Endoglin/ENG/CD105 Protein, Human
Artikelnummer: ABB-RP01912
Hersteller Artikelnummer: RP01912
Alternativnummer: ABB-RP01912-500UG,ABB-RP01912-50UG,ABB-RP01912-20UG,ABB-RP01912-10UG,ABB-RP01912-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Glu27-Gly581
Alternative Synonym: Endoglin, Cell surface MJ7/18 antigen, CD105,Eng, Edg
ENG,Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis .Required for normal structure and integrity of adult vasculature .Regulates the migration of vascular endothelial cells .Required for normal extraembryonic angiogenesis and for embryonic heart development .May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis .May play a role in the binding of endothelial cells to integrins. Acts as a TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors .Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3 .
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 60.71 kDa
NCBI: 13805
UniProt: Q63961
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI
Target-Kategorie: Eng
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related