Recombinant Mouse Endoglin/ENG/CD105 Protein, Human

Catalog Number: ABB-RP01912
Article Name: Recombinant Mouse Endoglin/ENG/CD105 Protein, Human
Biozol Catalog Number: ABB-RP01912
Supplier Catalog Number: RP01912
Alternative Catalog Number: ABB-RP01912-500UG,ABB-RP01912-50UG,ABB-RP01912-20UG,ABB-RP01912-10UG,ABB-RP01912-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Glu27-Gly581
Alternative Names: Endoglin, Cell surface MJ7/18 antigen, CD105,Eng, Edg
ENG,Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis .Required for normal structure and integrity of adult vasculature .Regulates the migration of vascular endothelial cells .Required for normal extraembryonic angiogenesis and for embryonic heart development .May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis .May play a role in the binding of endothelial cells to integrins. Acts as a TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors .Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3 .
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 60.71 kDa
NCBI: 13805
UniProt: Q63961
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI
Target: Eng
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related