Recombinant Human IFN-alpha G/IFNA5 Protein

Artikelnummer: ABB-RP01915
Artikelname: Recombinant Human IFN-alpha G/IFNA5 Protein
Artikelnummer: ABB-RP01915
Hersteller Artikelnummer: RP01915
Alternativnummer: ABB-RP01915-50UG,ABB-RP01915-500UG,ABB-RP01915-20UG,ABB-RP01915-10UG,ABB-RP01915-100UG,ABB-RP01915-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Leu22-Glu189
Alternative Synonym: Ifa5, IFNA5, IFNalpha G, IFN-alpha G, IFN-alpha-5, IFN-alphaG, INFA5, interferon alpha-5, Interferon alpha-61, Interferon alpha-G, interferon, alpha 5, LeIF G
Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 20.53 kDa
NCBI: 3442
UniProt: P01569
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Target-Kategorie: IFNA5
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors