Recombinant Human IFN-alpha G/IFNA5 Protein

Catalog Number: ABB-RP01915
Article Name: Recombinant Human IFN-alpha G/IFNA5 Protein
Biozol Catalog Number: ABB-RP01915
Supplier Catalog Number: RP01915
Alternative Catalog Number: ABB-RP01915-50UG,ABB-RP01915-500UG,ABB-RP01915-20UG,ABB-RP01915-10UG,ABB-RP01915-100UG,ABB-RP01915-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Leu22-Glu189
Alternative Names: Ifa5, IFNA5, IFNalpha G, IFN-alpha G, IFN-alpha-5, IFN-alphaG, INFA5, interferon alpha-5, Interferon alpha-61, Interferon alpha-G, interferon, alpha 5, LeIF G
Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 20.53 kDa
NCBI: 3442
UniProt: P01569
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Target: IFNA5
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors