Recombinant Human Mucin-2 /MUC2 Protein

Artikelnummer: ABB-RP01931LQ
Artikelname: Recombinant Human Mucin-2 /MUC2 Protein
Artikelnummer: ABB-RP01931LQ
Hersteller Artikelnummer: RP01931LQ
Alternativnummer: ABB-RP01931LQ-100UG,ABB-RP01931LQ-1000UG,ABB-RP01931LQ-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly858-Thr1259
Alternative Synonym: MUC2, SMUC,Mucin-2, MUC-2, Intestinal mucin-2
MUC2 Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 45.63 kDa
NCBI: 4583
UniProt: Q02817
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Supplied as 0.22 µm filtered solution in PBS,10% glycerol,pH7.4.
Sequenz: TCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRT
Target-Kategorie: MUC2
Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS,10% glycerol,pH7.4.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein