Recombinant Human Mucin-2 /MUC2 Protein

Catalog Number: ABB-RP01931LQ
Article Name: Recombinant Human Mucin-2 /MUC2 Protein
Biozol Catalog Number: ABB-RP01931LQ
Supplier Catalog Number: RP01931LQ
Alternative Catalog Number: ABB-RP01931LQ-100UG,ABB-RP01931LQ-1000UG,ABB-RP01931LQ-500UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Gly858-Thr1259
Alternative Names: MUC2, SMUC,Mucin-2, MUC-2, Intestinal mucin-2
MUC2 Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 45.63 kDa
NCBI: 4583
UniProt: Q02817
Purity: 90% as determined by SDS-PAGE.
Form: Supplied as 0.22 µm filtered solution in PBS,10% glycerol,pH7.4.
Sequence: TCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRT
Target: MUC2
Application Dilute: Supplied as 0.22 µm filtered solution in PBS,10% glycerol,pH7.4.
Application Notes: ResearchArea: Other Recombinant Protein