Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein

Produktübersicht

• Artikelname: Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein
• Artikelnummer: ABB-RP01933
• Hersteller Artikelnummer: RP01933
• Alternativnummer: ABB-RP01933-10UG,ABB-RP01933-100UG,ABB-RP01933-20UG,ABB-RP01933-50UG,ABB-RP01933-500UG,ABB-RP01933-1000UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Lys39
• Alternative Synonym: CXCR1, CMKAR1, IL8RA,C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181

Produktbeschreibung

Human CXC-chemokine receptor 1/CXCR1,Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor .Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Produkteigenschaften

• Konzentration: < 0.01 EU/µg of the protein by LAL method
• Molekulargewicht: 30.47 kDa
• NCBI: 3577
• UniProt: P25024
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequenz: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
• Target-Kategorie: CXCR1

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein