CXCR1, CMKAR1, IL8RA,C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181
Human CXC-chemokine receptor 1/CXCR1,Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor .Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence:
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Target:
CXCR1
Application Dilute:
Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes:
Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
* VAT and and shipping costs not included. Errors and price changes excepted