Recombinant Human Mature GDNF Protein

Artikelnummer: ABB-RP01954
Artikelname: Recombinant Human Mature GDNF Protein
Artikelnummer: ABB-RP01954
Hersteller Artikelnummer: RP01954
Alternativnummer: ABB-RP01954-100UG, ABB-RP01954-20UG, ABB-RP01954-50UG, ABB-RP01954-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Immunogen: Arg109-Ile211
Alternative Synonym: GDNF,Glial cell line-derived neurotrophic factor, hGDNF, Astrocyte-derived trophic factor, ATF
Glial cell-derived neurotrophic factor (GDNF) is a protein that, in humans, is encoded by the GDNF gene. GDNF is a small protein that potently promotes the survival of many types of neurons. GDNF, that acts via classical neurotrophic mechanism, has been
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 12.46 kDa
NCBI: 2668
UniProt: P39905
Reinheit: > 95% by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Target-Kategorie: GDNF
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.