Recombinant Human Mature GDNF Protein

Catalog Number: ABB-RP01954
Article Name: Recombinant Human Mature GDNF Protein
Biozol Catalog Number: ABB-RP01954
Supplier Catalog Number: RP01954
Alternative Catalog Number: ABB-RP01954-100UG, ABB-RP01954-20UG, ABB-RP01954-50UG, ABB-RP01954-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Immunogen: Arg109-Ile211
Alternative Names: GDNF,Glial cell line-derived neurotrophic factor, hGDNF, Astrocyte-derived trophic factor, ATF
Glial cell-derived neurotrophic factor (GDNF) is a protein that, in humans, is encoded by the GDNF gene. GDNF is a small protein that potently promotes the survival of many types of neurons. GDNF, that acts via classical neurotrophic mechanism, has been
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 12.46 kDa
NCBI: 2668
UniProt: P39905
Purity: > 95% by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Target: GDNF
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.