Recombinant Human CCL15/MIP-5/HCC-2 Protein

Artikelnummer: ABB-RP01966
Artikelname: Recombinant Human CCL15/MIP-5/HCC-2 Protein
Artikelnummer: ABB-RP01966
Hersteller Artikelnummer: RP01966
Alternativnummer: ABB-RP01966-20UG,ABB-RP01966-50UG,ABB-RP01966-500UG,ABB-RP01966-1000UG,ABB-RP01966-10UG,ABB-RP01966-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser46-Ile113
Alternative Synonym: CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 8.2 KDa
NCBI: 6359
UniProt: Q16663
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Target-Kategorie: CCL15, MIP5, NCC3, SCYA15
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors